PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do001332.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 773aa    MW: 81069 Da    PI: 7.1499
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do001332.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-095786151954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Do001332.1 578 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 615
                 564459******************************88 PP

2BELL90.41.8e-294555091872
        BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  Vd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia+q+
  Do001332.1 455 HVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIASQL 509
                 59***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-60336507IPR006563POX domain
PfamPF075262.7E-50341506IPR006563POX domain
PROSITE profilePS5007112.6556619IPR001356Homeobox domain
SMARTSM003891.6E-9559623IPR001356Homeobox domain
CDDcd000864.43E-13559620No hitNo description
SuperFamilySSF466892.65E-17561626IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28562625IPR009057Homeodomain-like
PfamPF059203.9E-18576615IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MGIAAPPSQP GQTTTYVSQP NKSSAAISGR PATASSMSHS QGFHEGSSGV FGYSSDGFDR  60
PDSSQDHQQQ HVAQQSRRDK LRVQGFDPAA AAGHGLLPID GDEHAEPGAM YEHAAAAAGA  120
SNMLSEMFNF PAPPSGPSAT ELLASQMNAN YRFGLRQGPG GVAGLSGDGG WFGAGAAGRA  180
GLVLGGTNMG SLGETSSPKQ QGSMAGLATD PATAMQLFLM NPQQQQSRSS PTSPQPSDVQ  240
HHEAFQAFGS AAASFGGGGA GVMEGQGLSL SLSPSLQQLE MAKQAEELRV RDGVLYFNRQ  300
PQQQQGPSAV QQLPMALHGG QVGALGQQLH VGYGPAGVAG VLRNSKYTRA AQELLEEFCS  360
VGRGQIKGGA RGGRGASASN NPNASKGGGG GASSSGAAQS PSSASKEPPQ LSPADRFEHQ  420
RKKAKLISML DEARPPLHHR LSSFLSCMHG MAWLHVDRRY NHYCDQMQMV VNFFDSVMGF  480
GAATPYTALA QKAMSRHFRC LKDAIASQLR HTCELLGEKD AGTSSGLTKG ETPRLRAIDQ  540
SLRQQRAFHH MGMMEQEAWR PQRGLPERSV NILRSWLFEH FLHPYPSDAD KHLLARQTGL  600
SRNQVSNWFI NARVRLWKPM IEEMYQQECR ELEGSSAGGG GPESGNDPSA ADDTHSPTTT  660
GAAQLPQQQH GTAAPGVTMP HKPDPGAVGP SAADAAFVGI DPVELLGGDA HVGGGADDLY  720
GRFEPGVRMR YGPGATAAAA GDVSLTLGLQ HAGAGNAGPD GTGRFSLRDY SGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-17565622158Homeobox protein Meis1
4xrs_A1e-17565622158Homeobox protein Meis1
5bng_A2e-17565623159Homeobox protein Meis2
5bng_B2e-17565623159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9575010.0EU957501.1 Zea mays clone 1595427 homeodomain protein JUBEL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-135BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLF2CYW10.0F2CYW1_HORVD; Predicted protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-121BEL1-like homeodomain 4